H00007869-A01

SEMA3B antibody from Abnova Corporation
LUCA-1, SemA, sema5, SEMAA, semaV
No application information provided.

Antibody data

Product number
H00007869-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007869-A01, RRID:AB_1139222
Product name
SEMA3B polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00007869-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant SEMA3B.
Antigen sequence
FTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGP
KLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLP
LESRRKGRNRRTHAPEPRAERGPRSATH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -