HPA016495

TMEM248 antibody from Sigma-Aldrich
C7orf42, FLJ10099, FLJ13090
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016495
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016495, RRID:AB_1848643
Product name
Anti-C7orf42 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016495
Antibody type
Polyclonal
Antigen
UPF0458 protein C7orf42 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLSGREAHEEINITFTLPTAWSSDDCALHGHCEQV
VFTACMTLTASPGVFPVTVQPPHCVPDTYSNATLW
YKIFTTARDANTKYAQDYNPF
Storage
-20C
Provider Type Product Number
- No reagents -