HPA016495

TMEM248 antibody from Atlas Antibodies
C7orf42, FLJ10099, FLJ13090
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016495
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016495, RRID:AB_1234323
Product name
Anti-TMEM248
Provider product page
Atlas Antibodies - HPA016495
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GLSGREAHEEINITFTLPTAWSSDDCALHGHCEQV
VFTACMTLTASPGVFPVTVQPPHCVPDTYSNATLW
YKIFTTARDANTKYAQDYNPF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -