Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502476 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC15A4 antibody: synthetic peptide directed towards the middle region of human SLC15A4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLV
KEKTI NQTIGNVVYH- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Search for type 2 diabetes susceptibility genes on chromosomes 1q, 3q and 12q.
Takeuchi F, Ochiai Y, Serizawa M, Yanai K, Kuzuya N, Kajio H, Honjo S, Takeda N, Kaburagi Y, Yasuda K, Shirasawa S, Sasazuki T, Kato N
Journal of human genetics 2008;53(4):314-24
Journal of human genetics 2008;53(4):314-24
No comments: Submit comment
No validations: Submit validation data