HPA016713

SLC15A4 antibody from Sigma-Aldrich
PHT1, PTR4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016713
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016713, RRID:AB_1856978
Product name
Anti-SLC15A4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016713
Antibody type
Polyclonal
Antigen
Solute carrier family 15, member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEG
IGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK
Storage
-20C
Provider Type Product Number
- No reagents -