HPA015996

TSPAN3 antibody from Sigma-Aldrich
TM4-A, TM4SF8, TSPAN-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015996
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015996, RRID:AB_1858406
Product name
Anti-TSPAN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015996
Antibody type
Polyclonal
Antigen
Tetraspanin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDW
FKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEG
CEALVVKKLQEI
Storage
-20C
Provider Type Product Number
- No reagents -