HPA014719

CMTM2 antibody from Sigma-Aldrich
CKLFSF2, FLJ25732, MGC39436
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014719
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014719, RRID:AB_1846996
Product name
Anti-CMTM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014719
Antibody type
Polyclonal
Antigen
CKLF-like MARVEL transmembrane domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEP
SDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFW
LLGHAEIKIRSL
Storage
-20C
Provider Type Product Number
- No reagents -