Antibody data

Product number
H00010567-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010567-M01, RRID:AB_1137405
Product name
RABAC1 monoclonal antibody (M01), clone 2A4
Provider product page
Abnova Corporation - H00010567-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RABAC1.
Antigen sequence
MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWL
ERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRN
VEYYQSN
Isotype
IgG
Antibody clone number
2A4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -