Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009473-D01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009473-D01P, RRID:AB_1571835
- Product name
- C1orf38 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human C1orf38 protein.
- Antigen sequence
MHLGIRSARCVLGMEGQQVILHLPLSQKGPFWTWE
PSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRP
QYEIQAIMHSELPGQMDARCWGRERGLPLGAALME
DTPTPSLRISWNFRLLPLYYTEVILFF- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of C1orf38 expression in transfected 293T cell line (H00009473-T02) by C1orf38 MaxPab polyclonal antibody.Lane 1: C1orf38 transfected lysate(15.10 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- C1orf38 MaxPab rabbit polyclonal antibody. Western Blot analysis of C1orf38 expression in K-562.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to C1orf38 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol