HPA031096

THEMIS2 antibody from MilliporeSigma / Merck KGaA
C1orf38, ICB-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031096
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031096, RRID:AB_10599254
Product name
Anti-C1orf38 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031096
Antibody type
Polyclonal
Antigen
Protein THEMIS2 (Thymocyte-expressed molecule involved in selection protein 2)(Induced by contact to basement membrane 1 protein)(Protein ICB-1) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSL
ILRPQYEIQAIMHMRRTIVKIPSTLEVDVEDVTAS
SRHVHFIKPLLLS
Storage
-20C
Provider Type Product Number
- No reagents -