H00162427-B01P

RETREG3 antibody from Abnova Corporation
DKFZp686B1036, FAM134C, FLJ33806
No application information provided.

Antibody data

Product number
H00162427-B01P
Provider
Abnova Corporation
Product name
FAM134C purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00162427-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FAM134C protein.
Antigen sequence
MAEAEGVPTTPGPASGSTFRGRRDVSGSWERDQQV
EAAQRALVEVLGPYEPLLSRVQAALVWERPARSAL
WCLGLNAAFWFFALTSLRLVFLLAFGLMIIVCIDQ
WKNKIWPEIKVPRPDALDNESWGFVHPRLLSVPEL
CHHVAEVWVSGTIFIRNVLLFKKQNPGKFCLLSCG
ILTFLAVLGRYVPGLLLSYLMLVTVMMWPLAVYHR
LWDRAYVRLKPALQRLDFSVRGYMMSKQRERQLRR
RALHPERAMDNHSDSEEELAAFCPQLDDSTVAREL
AITDSEHSDAEVSCTDNGTFNLSRGQTPLTEGSED
LDGHSDPEESFARDLPDFPSINMDPAGLDDEDDTS
IGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLG
ALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSG
APAQRATRGFLRSPSSDLDTDAEGDDFELLDQSEL
SQLDPASSRSH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -