SAB2100754

RETREG3 antibody from Sigma-Aldrich
DKFZp686B1036, FAM134C, FLJ33806
No application information provided.

Antibody data

Product number
SAB2100754
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100754, RRID:AB_10604775
Product name
Anti-FAM134C antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100754
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_835227.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAAQRALVEVLGPYEPLLSRVQAALVWERPARSAL
WCLGLNAAFWFFALT
Storage
-20C
Provider Type Product Number
- No reagents -