Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00200734-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00200734-M01, RRID:AB_490032
- Product name
- SPRED2 monoclonal antibody (M01), clone 6G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SPRED2.
- Antigen sequence
EDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSN
SSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPT
DHYHLDQPMPRPCRQVSFPDDDEEIVRINP- Isotype
- IgG
- Antibody clone number
- 6G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Spred-2 steady-state levels are regulated by phosphorylation and Cbl-mediated ubiquitination.
Lock P, I ST, Straffon AF, Schieb H, Hovens CM, Stylli SS
Biochemical and biophysical research communications 2006 Dec 29;351(4):1018-23
Biochemical and biophysical research communications 2006 Dec 29;351(4):1018-23
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SPRED2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol