H00051013-B02

EXOSC1 antibody from Abnova Corporation
CGI-108, CSL4, Csl4p, hCsl4p, p13, SKI4, Ski4p

Antibody data

Product number
H00051013-B02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051013-B02, RRID:AB_1138749
Product name
EXOSC1 MaxPab mouse polyclonal antibody (B02)
Provider product page
Abnova Corporation - H00051013-B02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EXOSC1 protein.
Antigen sequence
MAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFS
SLAGCLMKSSENGALPVVSVVRETESQLLPDVGAI
VTCKVSSINSRFAKVHILYVGSMPLKNSFRGTIRK
EDVRATEKDKVEIYKSFRPGDIVLAKVISLGDAQS
NYLLTTAENELGVVVAHSESGIQMVPISWCEMQCP
KTHTKEFRKVARVQPEFLQT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -