Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00112744-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00112744-B01P, RRID:AB_1237855
- Product name
- IL17F purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human IL17F protein.
- Antigen sequence
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPK
VGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSM
SRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNL
GCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVS
FQLEKVLVTVGCTCVTPVIHHVQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Verification of IL-17A and IL-17F in oral tissues and modulation of their expression pattern by steroid hormones.
Intratumoral regulatory T cells as an independent predictive factor for pathological complete response to neoadjuvant paclitaxel followed by 5-FU/epirubicin/cyclophosphamide in breast cancer patients.
Konermann A, Winter J, Novak N, Allam JP, Jäger A
Cellular immunology 2013 Sep-Oct;285(1-2):133-40
Cellular immunology 2013 Sep-Oct;285(1-2):133-40
Intratumoral regulatory T cells as an independent predictive factor for pathological complete response to neoadjuvant paclitaxel followed by 5-FU/epirubicin/cyclophosphamide in breast cancer patients.
Oda N, Shimazu K, Naoi Y, Morimoto K, Shimomura A, Shimoda M, Kagara N, Maruyama N, Kim SJ, Noguchi S
Breast cancer research and treatment 2012 Nov;136(1):107-16
Breast cancer research and treatment 2012 Nov;136(1):107-16
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of IL17F expression in transfected 293T cell line (H00112744-T01) by IL17F MaxPab polyclonal antibody.Lane 1: IL17F transfected lysate(17.93 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of purified MaxPab antibody to IL17F on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol