Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008692-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008692-A01, RRID:AB_1139208
- Product name
- HYAL2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HYAL2.
- Antigen sequence
CQYLKDYLTRLLVPYVVNVSWATQYCSRAQCHGHG
RCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRP
VGELSWADIDHLQTHFRCQCYLGWSGEQCQ- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hyaluronan synthases and hyaluronidases in nasal polyps.
Reactive oxygen species and hyaluronidase 2 regulate airway epithelial hyaluronan fragmentation.
Hyaluronidase expression and activity is regulated by pro-inflammatory cytokines in human airway epithelial cells.
Panogeorgou T, Tserbini E, Filou S, Vynios DH, Naxakis SS, Papadas TA, Goumas PD, Mastronikolis NS
European archives of oto-rhino-laryngology : official journal of the European Federation of Oto-Rhino-Laryngological Societies (EUFOS) : affiliated with the German Society for Oto-Rhino-Laryngology - Head and Neck Surgery 2016 Jul;273(7):1801-8
European archives of oto-rhino-laryngology : official journal of the European Federation of Oto-Rhino-Laryngological Societies (EUFOS) : affiliated with the German Society for Oto-Rhino-Laryngology - Head and Neck Surgery 2016 Jul;273(7):1801-8
Reactive oxygen species and hyaluronidase 2 regulate airway epithelial hyaluronan fragmentation.
Monzon ME, Fregien N, Schmid N, Falcon NS, Campos M, Casalino-Matsuda SM, Forteza RM
The Journal of biological chemistry 2010 Aug 20;285(34):26126-34
The Journal of biological chemistry 2010 Aug 20;285(34):26126-34
Hyaluronidase expression and activity is regulated by pro-inflammatory cytokines in human airway epithelial cells.
Monzón ME, Manzanares D, Schmid N, Casalino-Matsuda SM, Forteza RM
American journal of respiratory cell and molecular biology 2008 Sep;39(3):289-95
American journal of respiratory cell and molecular biology 2008 Sep;39(3):289-95
No comments: Submit comment
No validations: Submit validation data