HPA016502

GLRA1 antibody from Sigma-Aldrich
STHE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016502
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016502, RRID:AB_1849819
Product name
Anti-GLRA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016502
Antibody type
Polyclonal
Antigen
Glycine receptor subunit alpha-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLRFRRKRRHHKEDEAGEGRFNFSAYGMGPACLQA
KDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQR
AKKIDK
Storage
-20C
Provider Type Product Number
- No reagents -