Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010438-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010438-M03, RRID:AB_534802
- Product name
- C1D monoclonal antibody (M03), clone 6H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant C1D.
- Antigen sequence
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTM
MSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY
LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKK
AGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK
S- Isotype
- IgG
- Antibody clone number
- 6H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- C1D monoclonal antibody (M03), clone 6H2 Western Blot analysis of C1D expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of C1D expression in transfected 293T cell line by C1D monoclonal antibody (M03), clone 6H2.Lane 1: C1D transfected lysate(16 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged C1D is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to C1D on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to C1D on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
