Antibody data

Product number
H00010438-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010438-M10, RRID:AB_1571830
Product name
C1D monoclonal antibody (M10), clone 4H5
Provider product page
Abnova Corporation - H00010438-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant C1D.
Antigen sequence
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTM
MSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY
LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKK
AGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK
S
Isotype
IgG
Antibody clone number
4H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -