HPA030116

TUSC2 antibody from MilliporeSigma / Merck KGaA
C3orf11, FUS1, PAP, PDAP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030116
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030116, RRID:AB_10602253
Product name
Anti-TUSC2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030116
Antibody type
Polyclonal
Antigen
tumor suppressor candidate 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGR
AVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNG
QKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVI
Storage
-20C
Provider Type Product Number
- No reagents -