H00116115-B01

ZNF526 antibody from Abnova Corporation
KIAA1951, MGC4267

Antibody data

Product number
H00116115-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00116115-B01, RRID:AB_1139156
Product name
ZNF526 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00116115-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZNF526 protein.
Antigen sequence
MAEVVAEVAEMPTQMSPGAVEMSTPMSAEMMEMST
EVTEMTPGEALASSLFFQHHQFMCSECGSLYNTLE
EVLSHQEQHMLAVSEEEALTTQNVGLEPELVPGAE
GPFQCGECSQLILSPGELLAHQDAHLRESANQIQY
QCWDCQELFPSPELWVAHRKAQHLSATVAEPPVPP
PLPPPTPLPPPSPPSEVKMEPYECPECSTLCATPE
EFLEHQGTHFDSLEKEERNGLEEEEEDDEEDEEDD
EEMEDEEAMAEVGDDAVGGDESTAGWAQGCGDCPQ
HQPSAGARRQHRRTAHSPASATHPFHCSQCQRSFS
SANRLQAHGRAHVGGTHECTTCSKVFKKAASLEQH
LRLHRGEARYLCVDCGRGFGTELTLVAHRRAHTAN
PLHRCRCGKTFSNMTKFLYHRRTHAGKSGAPPTGA
TAPPAPAEPTPPPPPPAPPAQLPCPQCSKSFASAS
RLSRHRRAVHGPPERRHRCGVCGKGFKKLIHVRNH
LRTHTGERPFQCHSCGKTFASLANLSRHQLTHTGA
RPYQCLDCGKRFTQSSNLQQHRRLHLRPVAFARAP
RLPITGLYNKSPYYCGTCGRWFRAMAGLRLHQRVH
ARARTLTLQPPRSPSPAPPPPPEPQQTIMCTELGE
TIAIIETSQPLALEDTLQLCQAALGASEAGGLLQL
DTAFV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -