HPA003072

MN1 antibody from Sigma-Aldrich
MGCR, MGCR1, MGCR1-PEN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003072
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003072, RRID:AB_1079399
Product name
Anti-MN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003072
Antibody type
Polyclonal
Antigen
Probable tumor suppresor protein MN1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTPHEKALTSPSWGKGAELLLGDQPDLIGSLDGGA
KSDSSSPNVGEFASDEVSTSYANEDEVSSSSDNPQ
ALVKASRSPLVTGSPKLPPRGVGAGEHGPKAPPPA
LGLGIMSNSTSTPD
Storage
-20C
Provider Type Product Number
- No reagents -