Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051144-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051144-A01, RRID:AB_463346
- Product name
- HSD17B12 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant HSD17B12.
- Antigen sequence
SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVAT
KLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Overexpression of 17β-hydroxysteroid dehydrogenase type 1 increases the exposure of endometrial cancer to 17β-estradiol.
Cornel KM, Kruitwagen RF, Delvoux B, Visconti L, Van de Vijver KK, Day JM, Van Gorp T, Hermans RJ, Dunselman GA, Romano A
The Journal of clinical endocrinology and metabolism 2012 Apr;97(4):E591-601
The Journal of clinical endocrinology and metabolism 2012 Apr;97(4):E591-601
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HSD17B12 polyclonal antibody (A01), Lot # 060803QCS1. Western Blot analysis of HSD17B12 expression in SJCRH30.