Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051144-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051144-M08, RRID:AB_1674771
- Product name
- HSD17B12 monoclonal antibody (M08), clone 4G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HSD17B12.
- Antigen sequence
SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVAT
KLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG- Isotype
- IgG
- Antibody clone number
- 4G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in Jurkat(Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HSD17B12 monoclonal antibody (M08), clone 4G11. Western Blot analysis of HSD17B12 expression in human ovarian cancer.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HSD17B12 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol