HPA016427

HSD17B12 antibody from Sigma-Aldrich
KAR, SDR12C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016427
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016427, RRID:AB_1844347
Product name
Anti-HSD17B12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016427
Antibody type
Polyclonal
Antigen
Estradiol 17-beta-dehydrogenase 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELA
KHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIA
VDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEYP
EYFLDVPDLD
Storage
-20C
Provider Type Product Number
- No reagents -