HPA016427

HSD17B12 antibody from Atlas Antibodies
KAR, SDR12C1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016427
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016427, RRID:AB_1844347
Product name
Anti-HSD17B12
Provider product page
Atlas Antibodies - HPA016427
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELA
KHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIA
VDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEYP
EYFLDVPDLD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -