HPA026283

DNAJC8 antibody from Sigma-Aldrich
SPF31
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026283
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026283, RRID:AB_10600907
Product name
Anti-DNAJC8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026283
Antibody type
Polyclonal
Antigen
DnaJ (Hsp40) homolog, subfamily C, member 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELEIKRKEREAKEMHERKRQREEEIEAQEKAKRER
EWQKNFEESRDGRVDSWRNFQANTKGKKEKKNRTF
LRPPKVK
Storage
-20C
Provider Type Product Number
- No reagents -