H00114327-B01

EFHC1 antibody from Abnova Corporation
EJM, EJM1, FLJ10466

Antibody data

Product number
H00114327-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00114327-B01, RRID:AB_1138193
Product name
EFHC1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00114327-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EFHC1 protein.
Antigen sequence
MVSNPVHGLPFLPGTSFKDSTKTAFHRSQTLSYRN
GYAIVRRPTVGIGGDRLQFNQLSQAELDELASKAP
VLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQE
DVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVEN
SGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINIT
IYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALD
PYTELRKQPLRKYVTPSDFDQLKQFLTFDKQVLRF
YAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHE
RNDGIDPFPLLMNRQRVPKVLVENAKNFPQCVLEI
SDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPF
TRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYN
GFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVL
RYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPP
VRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDF
FIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSP
EALASIQNHVRKREAPAPEAESKQTEKDPGVQELE
ALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVD
RDMFFKICESLNVPVDDSLVKELLRMCSHGEGKIN
YYNFVRAFSN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -