Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00114327-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00114327-M09, RRID:AB_1674220
- Product name
- EFHC1 monoclonal antibody (M09), clone 4E7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EFHC1.
- Antigen sequence
DDTVEIREVHERNDGRDPFPLLMNRQRVPKVLVEN
AKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILG
RTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREP
PPVK- Isotype
- IgG
- Antibody clone number
- 4E7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EFHC1 expression in transfected 293T cell line by EFHC1 monoclonal antibody (M09), clone 4E7.Lane 1: EFHC1 transfected lysate (Predicted MW: 73.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EFHC1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol