Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Immunocytochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91189 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91189, RRID:AB_2665837
- Product name
- Anti-MCU
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
TRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQ
LKDAIAQAEMDLKRLRDPLQVHLPLRQIGE- Epitope
- Binds to an epitope located within the peptide sequence RDRQYLLFFH as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3576
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MCU antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of extracts from A-549 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-MCU monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-PPIB monoclonal antibody was used as loading control.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line A-549.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of A549 cells using the anti-MCU monoclonal antibody, showing specific staining in the mitochondria in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of A549 cells using the Anti-MCU monoclonal antibody, showing specific staining in the mitochondria in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN