HPA016480

MCU antibody from Sigma-Aldrich
C10orf42, CCDC109A, FLJ46135
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016480
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016480, RRID:AB_2071893
Product name
Anti-CCDC109A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016480
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 109A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQN
GLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQ
EEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKL
V
Storage
-20C
Provider Type Product Number
- No reagents -