HPA016480

MCU antibody from Atlas Antibodies
C10orf42, CCDC109A, FLJ46135
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016480
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016480, RRID:AB_2071893
Product name
Anti-MCU
Provider product page
Atlas Antibodies - HPA016480
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQN
GLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQ
EEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKL
V
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -