HPA016480

antibody from Atlas Antibodies

Targeting: MCU C10orf42, CCDC109A, FLJ46135

Provider product page for HPA016480

Western blot

Immunocytochemistry

Immunohistochemistry

Antibody data

Antibody Data
Antigen structure
References [92]
Comments [0]
Validations [0]

Submit

Product number: HPA016480 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA016480, RRID:AB_2071893
Product name: Anti-MCU
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: HHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQN GLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQ EEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKL V
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MCU protein structure - HPA016480 shown in red.

Submitted references Monitoring mitochondrial calcium in cardiomyocytes during coverslip hypoxia using a fluorescent lifetime indicator

Mastoor Y, Harata M, Silva K, Liu C, Combs C, Roman B, Murphy E
Journal of Molecular and Cellular Cardiology Plus 2024;8

BCL2L13 at endoplasmic reticulum-mitochondria contact sites regulates calcium homeostasis to maintain skeletal muscle function

Grepper D, Tabasso C, Zanou N, Aguettaz A, Castro-Sepulveda M, Ziegler D, Lagarrigue S, Arribat Y, Martinotti A, Ebrahimi A, Daraspe J, Fajas L, Amati F
iScience 2024;27(8):110510

The Use of Hexokinase 2-Displacing Peptides as an Anti-Neoplastic Approach for Malignant Peripheral Nerve Sheath Tumors

Ciscato F, Masgras I, Gori A, Fantuz M, Bergamaschi G, Komarov D, La Spina M, Ghasemi-Firouzabadi S, Pizzi M, Dei Tos A, Chiara F, Carrer A, Rasola A
Cells 2024;13(13):1162

Weissenrieder J, Peura J, Paudel U, Bhalerao N, Weinmann N, Johnson C, Wengyn M, Drager R, Furth E, Simin K, Ruscetti M, Stanger B, Rustgi A, Pitarresi J, Foskett J
2024

The mitochondrial calcium uniporter (MCU) activates mitochondrial respiration and enhances mobility by regulating mitochondrial redox state

Weiser A, Hermant A, Bermont F, Sizzano F, Karaz S, Alvarez-Illera P, Santo-Domingo J, Sorrentino V, Feige J, De Marchi U
Redox Biology 2023;64

Loss of mitochondrial Ca2+ uptake protein 3 impairs skeletal muscle calcium handling and exercise capacity

Roman B, Mastoor Y, Zhang Y, Gross D, Springer D, Liu C, Glancy B, Murphy E
The Journal of Physiology 2023;602(1):113-128

A mitochondrial inside-out iron-calcium signal reveals drug targets for Parkinson’s disease

Bharat V, Durairaj A, Vanhauwaert R, Li L, Muir C, Chandra S, Kwak C, Le Guen Y, Nandakishore P, Hsieh C, Rensi S, Altman R, Greicius M, Feng L, Wang X
Cell Reports 2023;42(12):113544

MICU1 controls the sensitivity of the mitochondrial Ca2+ uniporter to activators and inhibitors

Rodríguez-Prados M, Huang K, Márta K, Paillard M, Csordás G, Joseph S, Hajnóczky G
Cell Chemical Biology 2023;30(6):606-617.e4

Neuronal loss of NCLX-dependent mitochondrial calcium efflux mediates age-associated cognitive decline

Jadiya P, Cohen H, Kolmetzky D, Kadam A, Tomar D, Elrod J
iScience 2023;26(3):106296

Distinct effects of cardiac mitochondrial calcium uniporter inactivation via EMRE deletion in the short and long term

Chapoy Villanueva H, Sung J, Stevens J, Zhang M, Nelson P, Denduluri L, Feng F, O'Connell T, Townsend D, Liu J
Journal of Molecular and Cellular Cardiology 2023;181

The mitochondrial fusion protein OPA1 is dispensable in the liver and its absence induces mitohormesis to protect liver from drug-induced injury

Lee H, Lee T, Galloway C, Zhi W, Xiao W, de Mesy Bentley K, Sharma A, Teng Y, Sesaki H, Yoon Y
Nature Communications 2023;14(1)

MICU1 occludes the mitochondrial calcium uniporter in divalent-free conditions

Rodríguez-Prados M, Berezhnaya E, Castromonte M, Menezes-Filho S, Paillard M, Hajnóczky G
Proceedings of the National Academy of Sciences 2023;120(19)

Sexual dimorphism in bidirectional SR-mitochondria crosstalk in ventricular cardiomyocytes

Clements R, Terentyeva R, Hamilton S, Janssen P, Roder K, Martin B, Perger F, Schneider T, Nichtova Z, Das A, Veress R, Lee B, Kim D, Koren G, Stratton M, Csordas G, Accornero F, Belevych A, Gyorke S, Terentyev D
Basic Research in Cardiology 2023;118(1)

Mild Traumatic Brain Injury Induces Mitochondrial Calcium Overload and Triggers the Upregulation of NCLX in the Hippocampus.

Mira RG, Quintanilla RA, Cerpa W
Antioxidants (Basel, Switzerland) 2023 Feb 7;12(2)

Garbincius J, Luongo T, Lambert J, Mangold A, Murray E, Hildebrand A, Jadiya P, Elrod J
2023

Mitochondrial Alterations in Neurons Derived from the Murine AppNL-F Knock-In Model of Alzheimer’s Disease

Dentoni G, Naia L, Portal B, Leal N, Nilsson P, Lindskog M, Ankarcrona M
Journal of Alzheimer's Disease 2022;90(2):565-583

OPA1 Modulates Mitochondrial Ca2+ Uptake Through ER-Mitochondria Coupling

Cartes-Saavedra B, Macuada J, Lagos D, Arancibia D, Andrés M, Yu-Wai-Man P, Hajnóczky G, Eisner V
Frontiers in Cell and Developmental Biology 2022;9

Uncontrolled mitochondrial calcium uptake underlies the pathogenesis of neurodegeneration in MICU1-deficient mice and patients

Singh R, Bartok A, Paillard M, Tyburski A, Elliott M, Hajnóczky G
Science Advances 2022;8(11)

GDAP1 loss of function inhibits the mitochondrial pyruvate dehydrogenase complex by altering the actin cytoskeleton

Wolf C, Pouya A, Bitar S, Pfeiffer A, Bueno D, Rojas-Charry L, Arndt S, Gomez-Zepeda D, Tenzer S, Bello F, Vianello C, Ritz S, Schwirz J, Dobrindt K, Peitz M, Hanschmann E, Mencke P, Boussaad I, Silies M, Brüstle O, Giacomello M, Krüger R, Methner A
Communications Biology 2022;5(1)

Reduced ER–mitochondria connectivity promotes neuroblastoma multidrug resistance

Çoku J, Booth D, Skoda J, Pedrotty M, Vogel J, Liu K, Vu A, Carpenter E, Ye J, Chen M, Dunbar P, Scadden E, Yun T, Nakamaru‐Ogiso E, Area‐Gomez E, Li Y, Goldsmith K, Reynolds C, Hajnoczky G, Hogarty M
The EMBO Journal 2022;41(8)

Regulation of mitochondrial proteostasis by the proton gradient

Patron M, Tarasenko D, Nolte H, Kroczek L, Ghosh M, Ohba Y, Lasarzewski Y, Ahmadi Z, Cabrera‐Orefice A, Eyiama A, Kellermann T, Rugarli E, Brandt U, Meinecke M, Langer T
The EMBO Journal 2022;41(16)

Quantitative analysis of mitochondrial calcium uniporter (MCU) and essential MCU regulator (EMRE) in mitochondria from mouse tissues and HeLa cells

Watanabe A, Maeda K, Nara A, Hashida M, Ozono M, Nakao A, Yamada A, Shinohara Y, Yamamoto T
FEBS Open Bio 2022;12(4):811-826

Fundamental Role of Pentose Phosphate Pathway within the Endoplasmic Reticulum in Glutamine Addiction of Triple-Negative Breast Cancer Cells

Marini C, Cossu V, Carta S, Greotti E, Gaglio D, Bertola N, Chiesa S, Bruno S, Vitale F, Bonanomi M, Porro D, Riondato M, Orengo A, Bauckneht M, Morbelli S, Ravera S, Sambuceti G
Antioxidants 2022;12(1):43

SOD1 in ALS: Taking Stock in Pathogenic Mechanisms and the Role of Glial and Muscle Cells

Peggion C, Scalcon V, Massimino M, Nies K, Lopreiato R, Rigobello M, Bertoli A
Antioxidants 2022;11(4):614

Sex‐Specific Differences in Endothelial Function Are Driven by Divergent Mitochondrial Ca 2+ Handling

Damacena de Angelis C, Endoni B, Nuno D, Lamping K, Ledolter J, Koval O, Grumbach I
Journal of the American Heart Association 2022;11(13)

Altered composition of the mitochondrial Ca2+uniporter in the failing human heart

Paillard M, Huang K, Weaver D, Lambert J, Elrod J, Hajnóczky G
Cell Calcium 2022;105

Mitochondrial Ca2+ uniporter haploinsufficiency enhances long-term potentiation at hippocampal mossy fibre synapses.

Devine MJ, Szulc BR, Howden JH, López-Doménech G, Ruiz A, Kittler JT
Journal of cell science 2022 Nov 15;135(22)

Parvalbumin affects skeletal muscle trophism through modulation of mitochondrial calcium uptake

Butera G, Vecellio Reane D, Canato M, Pietrangelo L, Boncompagni S, Protasi F, Rizzuto R, Reggiani C, Raffaello A
Cell Reports 2021;35(5):109087

Identification and functional validation of FDA-approved positive and negative modulators of the mitochondrial calcium uniporter

De Mario A, Tosatto A, Hill J, Kriston-Vizi J, Ketteler R, Vecellio Reane D, Cortopassi G, Szabadkai G, Rizzuto R, Mammucari C
Cell Reports 2021;35(12):109275

MCU overexpression evokes disparate dose-dependent effects on mito-ROS and spontaneous Ca2+ release in hypertrophic rat cardiomyocytes

Hamilton S, Terentyeva R, Perger F, Hernández Orengo B, Martin B, Gorr M, Belevych A, Clements R, Györke S, Terentyev D
American Journal of Physiology-Heart and Circulatory Physiology 2021;321(4):H615-H632

Regulation of Endoplasmic Reticulum–Mitochondria Tethering and Ca2+ Fluxes by TDP-43 via GSK3β

Peggion C, Massimino M, Bonadio R, Lia F, Lopreiato R, Cagnin S, Calì T, Bertoli A
International Journal of Molecular Sciences 2021;22(21):11853

Neuronal cell-based high-throughput screen for enhancers of mitochondrial function reveals luteolin as a modulator of mitochondria-endoplasmic reticulum coupling

Naia L, Pinho C, Dentoni G, Liu J, Leal N, Ferreira D, Schreiner B, Filadi R, Fão L, Connolly N, Forsell P, Nordvall G, Shimozawa M, Greotti E, Basso E, Theurey P, Gioran A, Joselin A, Arsenian-Henriksson M, Nilsson P, Rego A, Ruas J, Park D, Bano D, Pizzo P, Prehn J, Ankarcrona M
BMC Biology 2021;19(1)

Dual-process brain mitochondria isolation preserves function and clarifies protein composition

Noterman M, Chaubey K, Lin-Rahardja K, Rajadhyaksha A, Pieper A, Taylor E
Proceedings of the National Academy of Sciences 2021;118(11)

Changes in Gene Expression of the MCU Complex Are Induced by Electrical Stimulation in Adult Skeletal Muscle

Quezada E, Díaz-Vegas A, Jaimovich E, Casas M
Frontiers in Physiology 2021;11

Calcium Signaling and Mitochondrial Function in Presenilin 2 Knock-Out Mice: Looking for Any Loss-of-Function Phenotype Related to Alzheimer’s Disease

Rossi A, Galla L, Gomiero C, Zentilin L, Giacca M, Giorgio V, Calì T, Pozzan T, Greotti E, Pizzo P
Cells 2021;10(2):204

The mechanism of MICU-dependent gating of the mitochondrial Ca2+uniporter

Garg V, Suzuki J, Paranjpe I, Unsulangi T, Boyman L, Milescu L, Lederer W, Kirichok Y
eLife 2021;10

The effect of mitochondrial calcium uniporter and cyclophilin D knockout on resistance of brain mitochondria to Ca(2+)-induced damage.

Hamilton J, Brustovetsky T, Brustovetsky N
The Journal of biological chemistry 2021 Jan-Jun;296:100669

Knockout of the Mitochondrial Calcium Uniporter Strongly Suppresses Stimulus-Metabolism Coupling in Pancreatic Acinar Cells but Does Not Reduce Severity of Experimental Acute Pancreatitis

Chvanov M, Voronina S, Zhang X, Telnova S, Chard R, Ouyang Y, Armstrong J, Tanton H, Awais M, Latawiec D, Sutton R, Criddle D, Tepikin A
Cells 2020;9(6):1407

Transmembrane BAX Inhibitor-1 Motif Containing Protein 5 (TMBIM5) Sustains Mitochondrial Structure, Shape, and Function by Impacting the Mitochondrial Protein Synthesis Machinery

Seitaj B, Maull F, Zhang L, Wüllner V, Wolf C, Schippers P, La Rovere R, Distler U, Tenzer S, Parys J, Bultynck G, Methner A
Cells 2020;9(10):2147

Na+ controls hypoxic signalling by the mitochondrial respiratory chain

Hernansanz-Agustín P, Choya-Foces C, Carregal-Romero S, Ramos E, Oliva T, Villa-Piña T, Moreno L, Izquierdo-Álvarez A, Cabrera-García J, Cortés A, Lechuga-Vieco A, Jadiya P, Navarro E, Parada E, Palomino-Antolín A, Tello D, Acín-Pérez R, Rodríguez-Aguilera J, Navas P, Cogolludo Á, López-Montero I, Martínez-del-Pozo Á, Egea J, López M, Elrod J, Ruíz-Cabello J, Bogdanova A, Enríquez J, Martínez-Ruiz A
Nature 2020;586(7828):287-291

EMRE is essential for mitochondrial calcium uniporter activity in a mouse model

Liu J, Syder N, Ghorashi N, Willingham T, Parks R, Sun J, Fergusson M, Liu J, Holmström K, Menazza S, Springer D, Liu C, Glancy B, Finkel T, Murphy E
JCI Insight 2020;5(4)

A High-Throughput Screening Identifies MICU1 Targeting Compounds

Di Marco G, Vallese F, Jourde B, Bergsdorf C, Sturlese M, De Mario A, Techer-Etienne V, Haasen D, Oberhauser B, Schleeger S, Minetti G, Moro S, Rizzuto R, De Stefani D, Fornaro M, Mammucari C
Cell Reports 2020;30(7):2321-2331.e6

Evolutionary divergence reveals the molecular basis of EMRE dependence of the human MCU

MacEwen M, Markhard A, Bozbeyoglu M, Bradford F, Goldberger O, Mootha V, Sancak Y
Life Science Alliance 2020;3(10):e202000718

Cancer cells with defective oxidative phosphorylation require endoplasmic reticulum–to–mitochondria Ca 2+ transfer for survival

Cardenas C, Lovy A, Silva-Pavez E, Urra F, Mizzoni C, Ahumada-Castro U, Bustos G, Jaňa F, Cruz P, Farias P, Mendoza E, Huerta H, Murgas P, Hunter M, Rios M, Cerda O, Georgakoudi I, Zakarian A, Molgó J, Foskett J
Science Signaling 2020;13(640)

Increased RyR2 activity is exacerbated by calcium leak-induced mitochondrial ROS

Hamilton S, Terentyeva R, Martin B, Perger F, Li J, Stepanov A, Bonilla I, Knollmann B, Radwański P, Györke S, Belevych A, Terentyev D
Basic Research in Cardiology 2020;115(4)

Increased mitochondrial calcium levels associated with neuronal death in a mouse model of Alzheimer’s disease

Calvo-Rodriguez M, Hou S, Snyder A, Kharitonova E, Russ A, Das S, Fan Z, Muzikansky A, Garcia-Alloza M, Serrano-Pozo A, Hudry E, Bacskai B
Nature Communications 2020;11(1)

Discovery of EMRE in fungi resolves the true evolutionary history of the mitochondrial calcium uniporter

Pittis A, Goh V, Cebrian-Serrano A, Wettmarshausen J, Perocchi F, Gabaldón T
Nature Communications 2020;11(1)

Oxygen Glucose Deprivation Induced Prosurvival Autophagy Is Insufficient to Rescue Endothelial Function

Natarajan V, Mah T, Peishi C, Tan S, Chawla R, Arumugam T, Ramasamy A, Mallilankaraman K
Frontiers in Physiology 2020;11

Pyrroloquinoline quinone can prevent chronic heart failure by regulating mitochondrial function

Xu X, Chen C, Lu W, Su Y, Shi J, Liu Y, Wang L, Xiao C, Wu X, Lu Q
Cardiovascular Diagnosis and Therapy 2020;10(3):453-469

Identification of an ATP-sensitive potassium channel in mitochondria

Paggio A, Checchetto V, Campo A, Menabò R, Di Marco G, Di Lisa F, Szabo I, Rizzuto R, De Stefani D
Nature 2019;572(7771):609-613

The mitochondrial calcium uniporter is crucial for the generation of fast cortical network rhythms

Bas-Orth C, Schneider J, Lewen A, McQueen J, Hasenpusch-Theil K, Theil T, Hardingham G, Bading H, Kann O
Journal of Cerebral Blood Flow & Metabolism 2019;40(11):2225-2239

Dysregulation of Mitochondrial Ca2+ Uptake and Sarcolemma Repair Underlie Muscle Weakness and Wasting in Patients and Mice Lacking MICU1

Debattisti V, Horn A, Singh R, Seifert E, Hogarth M, Mazala D, Huang K, Horvath R, Jaiswal J, Hajnóczky G
Cell Reports 2019;29(5):1274-1286.e6

Impaired cellular bioenergetics caused by GBA1 depletion sensitizes neurons to calcium overload

Plotegher N, Perocheau D, Ferrazza R, Massaro G, Bhosale G, Zambon F, Rahim A, Guella G, Waddington S, Szabadkai G, Duchen M
Cell Death & Differentiation 2019;27(5):1588-1603

ALS-Associated SOD1(G93A) Decreases SERCA Pump Levels and Increases Store-Operated Ca2+ Entry in Primary Spinal Cord Astrocytes from a Transgenic Mouse Model

Norante R, Peggion C, Rossi D, Martorana F, De Mario A, Lia A, Massimino M, Bertoli A
International Journal of Molecular Sciences 2019;20(20):5151

High mitochondrial Ca2+ content increases cancer cell proliferation upon inhibition of mitochondrial permeability transition pore (mPTP)

Marchi S, Vitto V, Patergnani S, Pinton P
Cell Cycle 2019;18(8):914-916

Mitochondrial Calcium Transporters Mediate Sensitivity to Noise-Induced Losses of Hair Cells and Cochlear Synapses

Wang X, Zhu Y, Long H, Pan S, Xiong H, Fang Q, Hill K, Lai R, Yuan H, Sha S
Frontiers in Molecular Neuroscience 2019;11

Impaired mitochondrial calcium efflux contributes to disease progression in models of Alzheimer’s disease

Jadiya P, Kolmetzky D, Tomar D, Di Meco A, Lombardi A, Lambert J, Luongo T, Ludtmann M, Praticò D, Elrod J
Nature Communications 2019;10(1)

Mitochondrial calcium exchange links metabolism with the epigenome to control cellular differentiation

Lombardi A, Gibb A, Arif E, Kolmetzky D, Tomar D, Luongo T, Jadiya P, Murray E, Lorkiewicz P, Hajnóczky G, Murphy E, Arany Z, Kelly D, Margulies K, Hill B, Elrod J
Nature Communications 2019;10(1)

FOXD1-dependent MICU1 expression regulates mitochondrial activity and cell differentiation

Shanmughapriya S, Tomar D, Dong Z, Slovik K, Nemani N, Natarajaseenivasan K, Carvalho E, Lu C, Corrigan K, Garikipati V, Ibetti J, Rajan S, Barrero C, Chuprun K, Kishore R, Merali S, Tian Y, Yang W, Madesh M
Nature Communications 2018;9(1)

The ER Stress Inducer l-Azetidine-2-Carboxylic Acid Elevates the Levels of Phospho-eIF2α and of LC3-II in a Ca2+-Dependent Manner

Roest G, Hesemans E, Welkenhuyzen K, Luyten T, Engedal N, Bultynck G, Parys J
Cells 2018;7(12):239

Akt‐mediated phosphorylation of MICU 1 regulates mitochondrial Ca 2+ levels and tumor growth

Marchi S, Corricelli M, Branchini A, Vitto V, Missiroli S, Morciano G, Perrone M, Ferrarese M, Giorgi C, Pinotti M, Galluzzi L, Kroemer G, Pinton P
The EMBO Journal 2018;38(2)

Inhibition of the mitochondrial calcium uniporter prevents IL-13 and allergen-mediated airway epithelial apoptosis and loss of barrier function

Sebag S, Koval O, Paschke J, Winters C, Comellas A, Grumbach I
Experimental Cell Research 2018;362(2):400-411

Overexpression of hexokinase 2 reduces mitochondrial calcium overload in coronary endothelial cells of type 2 diabetic mice

Pan M, Han Y, Basu A, Dai A, Si R, Willson C, Balistrieri A, Scott B, Makino A
American Journal of Physiology-Cell Physiology 2018;314(6):C732-C740

Slow activation of fast mitochondrial Ca2+ uptake by cytosolic Ca2+

Basso E, Rigotto G, Zucchetti A, Pozzan T
Journal of Biological Chemistry 2018;293(44):17081-17094

Restoring mitochondrial calcium uniporter expression in diabetic mouse heart improves mitochondrial calcium handling and cardiac function

Suarez J, Cividini F, Scott B, Lehmann K, Diaz-Juarez J, Diemer T, Dai A, Suarez J, Jain M, Dillmann W
Journal of Biological Chemistry 2018;293(21):8182-8195

MICU1 imparts the mitochondrial uniporter with the ability to discriminate between Ca 2+ and Mn 2+

Kamer K, Sancak Y, Fomina Y, Meisel J, Chaudhuri D, Grabarek Z, Mootha V
Proceedings of the National Academy of Sciences 2018;115(34)

Deletion of mitochondrial calcium uniporter incompletely inhibits calcium uptake and induction of the permeability transition pore in brain mitochondria.

Hamilton J, Brustovetsky T, Rysted JE, Lin Z, Usachev YM, Brustovetsky N
The Journal of biological chemistry 2018 Oct 5;293(40):15652-15663

Mitochondrial Ca2+ Uniporter Is a Mitochondrial Luminal Redox Sensor that Augments MCU Channel Activity

Dong Z, Shanmughapriya S, Tomar D, Siddiqui N, Lynch S, Nemani N, Breves S, Zhang X, Tripathi A, Palaniappan P, Riitano M, Worth A, Seelam A, Carvalho E, Subbiah R, Jaña F, Soboloff J, Peng Y, Cheung J, Joseph S, Caplan J, Rajan S, Stathopulos P, Madesh M
Molecular Cell 2017;65(6):1014-1028.e7

The mitochondrial Na+/Ca2+ exchanger is essential for Ca2+ homeostasis and viability

Luongo T, Lambert J, Gross P, Nwokedi M, Lombardi A, Shanmughapriya S, Carpenter A, Kolmetzky D, Gao E, van Berlo J, Tsai E, Molkentin J, Chen X, Madesh M, Houser S, Elrod J
Nature 2017;545(7652):93-97

Newly born peroxisomes are a hybrid of mitochondrial and ER-derived pre-peroxisomes

Sugiura A, Mattie S, Prudent J, McBride H
Nature 2017;542(7640):251-254

Mitochondrial Calcium Dysregulation Contributes to Dendrite Degeneration Mediated by PD/LBD-Associated LRRK2 Mutants

Verma M, Callio J, Otero P, Sekler I, Wills Z, Chu C
The Journal of Neuroscience 2017;37(46):11151-11165

High‐affinity cooperative Ca2+ binding by MICU1–MICU2 serves as an on–off switch for the uniporter

Kamer K, Grabarek Z, Mootha V
EMBO reports 2017;18(8):1397-1411

Content of mitochondrial calcium uniporter (MCU) in cardiomyocytes is regulated by microRNA-1 in physiologic and pathologic hypertrophy

Zaglia T, Ceriotti P, Campo A, Borile G, Armani A, Carullo P, Prando V, Coppini R, Vida V, Stølen T, Ulrik W, Cerbai E, Stellin G, Faggian G, De Stefani D, Sandri M, Rizzuto R, Di Lisa F, Pozzan T, Catalucci D, Mongillo M
Proceedings of the National Academy of Sciences 2017;114(43)

Proteolytic control of the mitochondrial calcium uniporter complex

Tsai C, Wu Y, Pao P, Phillips C, Williams C, Miller C, Ranaghan M, Tsai M
Proceedings of the National Academy of Sciences 2017;114(17):4388-4393

The mitochondrial calcium uniporter regulates breast cancer progression via HIF ‐1α

Tosatto A, Sommaggio R, Kummerow C, Bentham R, Blacker T, Berecz T, Duchen M, Rosato A, Bogeski I, Szabadkai G, Rizzuto R, Mammucari C
EMBO Molecular Medicine 2016;8(5):569-585

Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex

Tsai M, Phillips C, Ranaghan M, Tsai C, Wu Y, Williams C, Miller C
eLife 2016;5

Physical exercise in aging human skeletal muscle increases mitochondrial calcium uniporter expression levels and affects mitochondria dynamics

Zampieri S, Mammucari C, Romanello V, Barberi L, Pietrangelo L, Fusella A, Mosole S, Gherardi G, Höfer C, Löfler S, Sarabon N, Cvecka J, Krenn M, Carraro U, Kern H, Protasi F, Musarò A, Sandri M, Rizzuto R
Physiological Reports 2016;4(24)

Mitochondrial Calcium Uptake Modulates Synaptic Vesicle Endocytosis in Central Nerve Terminals

Marland J, Hasel P, Bonnycastle K, Cousin M
Journal of Biological Chemistry 2016;291(5):2080-2086

Strategic Positioning and Biased Activity of the Mitochondrial Calcium Uniporter in Cardiac Muscle

De La Fuente S, Fernandez-Sanz C, Vail C, Agra E, Holmstrom K, Sun J, Mishra J, Williams D, Finkel T, Murphy E, Joseph S, Sheu S, Csordás G
Journal of Biological Chemistry 2016;291(44):23343-23362

EMRE Is a Matrix Ca 2+ Sensor that Governs Gatekeeping of the Mitochondrial Ca 2+ Uniporter

Vais H, Mallilankaraman K, Mak D, Hoff H, Payne R, Tanis J, Foskett J
Cell Reports 2016;14(3):403-410

Critical reappraisal confirms that Mitofusin 2 is an endoplasmic reticulum–mitochondria tether

Naon D, Zaninello M, Giacomello M, Varanita T, Grespi F, Lakshminaranayan S, Serafini A, Semenzato M, Herkenne S, Hernández-Alvarez M, Zorzano A, De Stefani D, Dorn G, Scorrano L
Proceedings of the National Academy of Sciences 2016;113(40):11249-11254

The endoplasmic reticulum mitochondrial calcium cross talk is downregulated in malignant pleural mesothelioma cells and plays a critical role in apoptosis inhibition

Patergnani S, Giorgi C, Maniero S, Missiroli S, Maniscalco P, Bononi I, Martini F, Cavallesco G, Tognon M, Pinton P
Oncotarget 2015;6(27):23427-23444

EglN2 associates with the NRF1‐PGC1α complex and controls mitochondrial function in breast cancer

Zhang J, Wang C, Chen X, Takada M, Fan C, Zheng X, Wen H, Liu Y, Wang C, Pestell R, Aird K, Kaelin W, Liu X, Zhang Q
The EMBO Journal 2015;34(23):2953-2970

Essential Role of Mitochondrial Ca2+ Uniporter in the Generation of Mitochondrial pH Gradient and Metabolism-Secretion Coupling in Insulin-releasing Cells

Quan X, Nguyen T, Choi S, Xu S, Das R, Cha S, Kim N, Han J, Wiederkehr A, Wollheim C, Park K
Journal of Biological Chemistry 2015;290(7):4086-4096

Structure and function of the N‐terminal domain of the human mitochondrial calcium uniporter

Lee Y, Min C, Kim T, Song H, Lim Y, Kim D, Shin K, Kang M, Kang J, Youn H, Lee J, An J, Park K, Lim J, Kim J, Kim J, Park Z, Kim Y, Wang J, Kim D, Eom S
EMBO reports 2015;16(10):1318-1333

Chronic enrichment of hepatic endoplasmic reticulum–mitochondria contact leads to mitochondrial dysfunction in obesity

Arruda A, Pers B, Parlakgül G, Güney E, Inouye K, Hotamisligil G
Nature Medicine 2014;20(12):1427-1435

Quantitative Proteomics of Synaptic and Nonsynaptic Mitochondria: Insights for Synaptic Mitochondrial Vulnerability

Stauch K, Purnell P, Fox H
Journal of Proteome Research 2014;13(5):2620-2636

Reconstitution of the mitochondrial calcium uniporter in yeast

Kovács-Bogdán E, Sancak Y, Kamer K, Plovanich M, Jambhekar A, Huber R, Myre M, Blower M, Mootha V
Proceedings of the National Academy of Sciences 2014;111(24):8985-8990

Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling

Logan C, Szabadkai G, Sharpe J, Parry D, Torelli S, Childs A, Kriek M, Phadke R, Johnson C, Roberts N, Bonthron D, Pysden K, Whyte T, Munteanu I, Foley A, Wheway G, Szymanska K, Natarajan S, Abdelhamed Z, Morgan J, Roper H, Santen G, Niks E, van der Pol W, Lindhout D, Raffaello A, De Stefani D, den Dunnen J, Sun Y, Ginjaar I, Sewry C, Hurles M, Rizzuto R, Duchen M, Muntoni F, Sheridan E
Nature Genetics 2013;46(2):188-193

Mitochondrial calcium uniporter Mcu controls excitotoxicity and is transcriptionally repressed by neuroprotective nuclear calcium signals

Qiu J, Tan Y, Hagenston A, Martel M, Kneisel N, Skehel P, Wyllie D, Bading H, Hardingham G
Nature Communications 2013;4(1)

The physiological role of mitochondrial calcium revealed by mice lacking the mitochondrial calcium uniporter

Pan X, Liu J, Nguyen T, Liu C, Sun J, Teng Y, Fergusson M, Rovira I, Allen M, Springer D, Aponte A, Gucek M, Balaban R, Murphy E, Finkel T
Nature Cell Biology 2013;15(12):1464-1472

Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter

Baughman J, Perocchi F, Girgis H, Plovanich M, Belcher-Timme C, Sancak Y, Bao X, Strittmatter L, Goldberger O, Bogorad R, Koteliansky V, Mootha V
Nature 2011;476(7360):341-345

No comments: Submit comment

No validations: Submit validation data