Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA016480 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA016480, RRID:AB_2071893
- Product name
- Anti-MCU
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQN
GLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQ
EEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKL
V- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter
Quantitative proteomics of synaptic and nonsynaptic mitochondria: insights for synaptic mitochondrial vulnerability.
Reconstitution of the mitochondrial calcium uniporter in yeast.
Chronic enrichment of hepatic endoplasmic reticulum-mitochondria contact leads to mitochondrial dysfunction in obesity.
The physiological role of mitochondrial calcium revealed by mice lacking the mitochondrial calcium uniporter
Mitochondrial calcium uniporter Mcu controls excitotoxicity and is transcriptionally repressed by neuroprotective nuclear calcium signals
Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling
Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter
Lee Y, Min C, Kim T, Song H, Lim Y, Kim D, Shin K, Kang M, Kang J, Youn H, Lee J, An J, Park K, Lim J, Kim J, Kim J, Park Z, Kim Y, Wang J, Kim D, Eom S
EMBO reports 2015 October;16(10):1318-1333
EMBO reports 2015 October;16(10):1318-1333
Quantitative proteomics of synaptic and nonsynaptic mitochondria: insights for synaptic mitochondrial vulnerability.
Stauch KL, Purnell PR, Fox HS
Journal of proteome research 2014 May 2;13(5):2620-36
Journal of proteome research 2014 May 2;13(5):2620-36
Reconstitution of the mitochondrial calcium uniporter in yeast.
Kovács-Bogdán E, Sancak Y, Kamer KJ, Plovanich M, Jambhekar A, Huber RJ, Myre MA, Blower MD, Mootha VK
Proceedings of the National Academy of Sciences of the United States of America 2014 Jun 17;111(24):8985-90
Proceedings of the National Academy of Sciences of the United States of America 2014 Jun 17;111(24):8985-90
Chronic enrichment of hepatic endoplasmic reticulum-mitochondria contact leads to mitochondrial dysfunction in obesity.
Arruda AP, Pers BM, Parlakgül G, Güney E, Inouye K, Hotamisligil GS
Nature medicine 2014 Dec;20(12):1427-35
Nature medicine 2014 Dec;20(12):1427-35
The physiological role of mitochondrial calcium revealed by mice lacking the mitochondrial calcium uniporter
Pan X, Liu J, Nguyen T, Liu C, Sun J, Teng Y, Fergusson M, Rovira I, Allen M, Springer D, Aponte A, Gucek M, Balaban R, Murphy E, Finkel T
Nature Cell Biology 2013 November;15(12):1464-1472
Nature Cell Biology 2013 November;15(12):1464-1472
Mitochondrial calcium uniporter Mcu controls excitotoxicity and is transcriptionally repressed by neuroprotective nuclear calcium signals
Qiu J, Tan Y, Hagenston A, Martel M, Kneisel N, Skehel P, Wyllie D, Bading H, Hardingham G
Nature Communications 2013 June;4
Nature Communications 2013 June;4
Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling
Logan C, Szabadkai G, Sharpe J, Parry D, Torelli S, Childs A, Kriek M, Phadke R, Johnson C, Roberts N, Bonthron D, Pysden K, Whyte T, Munteanu I, Foley A, Wheway G, Szymanska K, Natarajan S, Abdelhamed Z, Morgan J, Roper H, Santen G, Niks E, van der Pol W, Lindhout D, Raffaello A, De Stefani D, den Dunnen J, Sun Y, Ginjaar I, Sewry C, Hurles M, Rizzuto R, Duchen M, Muntoni F, Sheridan E
Nature Genetics 2013 December;46(2):188-193
Nature Genetics 2013 December;46(2):188-193
Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter
Baughman J, Perocchi F, Girgis H, Plovanich M, Belcher-Timme C, Sancak Y, Bao X, Strittmatter L, Goldberger O, Bogorad R, Koteliansky V, Mootha V
Nature 2011 June;476(7360):341-345
Nature 2011 June;476(7360):341-345
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MCU antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows moderate to strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows moderate to strong granular cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN