HPA035092

TRAM2 antibody from MilliporeSigma / Merck KGaA
KIAA0057
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035092
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035092, RRID:AB_10610562
Product name
Anti-TRAM2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035092
Antibody type
Polyclonal
Antigen
translocation associated membrane protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REYWNEQSAKRRVPATPRLPARLIKRESGYHENGV
VKAENGTSPRTKKLKSP
Storage
-20C
Provider Type Product Number
- No reagents -