Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005050-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005050-M02, RRID:AB_530159
- Product name
- PAFAH1B3 monoclonal antibody (M02), clone 8C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PAFAH1B3.
- Antigen sequence
MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSK
DKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNF
GIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNN
HGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLP
RGQHPNPLREKNRQVNELVRAALAGHPRAHFLDAD
PGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHS
LLLRLLAQDQGQGAPLLEPAP- Isotype
- IgG
- Antibody clone number
- 8C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Loss of PAFAH1B2 reduces amyloid-β generation by promoting the degradation of amyloid precursor protein C-terminal fragments.
Page RM, Münch A, Horn T, Kuhn PH, Colombo A, Reiner O, Boutros M, Steiner H, Lichtenthaler SF, Haass C
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Dec 12;32(50):18204-14
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Dec 12;32(50):18204-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PAFAH1B3 monoclonal antibody (M02), clone 8C11. Western Blot analysis of PAFAH1B3 expression in Jurkat ( Cat # L017V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PAFAH1B3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PAFAH1B3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol