HPA027429

MED18 antibody from MilliporeSigma / Merck KGaA
FLJ20045, p28b, SRB5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027429
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027429, RRID:AB_10610137
Product name
Anti-MED18 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027429
Antibody type
Polyclonal
Antigen
mediator complex subunit 18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNC
VDIATSENLTDFLMEMGFRMDHEFVAKGH
Storage
-20C
Provider Type Product Number
- No reagents -