PAB20787

TMEM234 antibody from Abnova Corporation
C1orf91, dJ622L5.7, FLJ90779, RP4-622L5

Antibody data

Product number
PAB20787
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20787, RRID:AB_10963528
Product name
TMEM234 polyclonal antibody
Provider product page
Abnova Corporation - PAB20787
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TMEM234.
Antigen sequence
DIGGKRKLDYCECGTQLCGSRHTCVSSFPEPISPE
WVRTRPFPILPFPLQLFCF
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -