HPA015049

TMEM234 antibody from Sigma-Aldrich
C1orf91, dJ622L5.7, FLJ90779, RP4-622L5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015049
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015049, RRID:AB_1856409
Product name
Anti-C1orf91 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015049
Antibody type
Polyclonal
Antigen
UPF0546 membrane protein C1orf91 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DIGGKRKLDYCECGTQLCGSRHTCVSSFPEPISPE
WVRTRPFPILPFPLQLFCF
Storage
-20C
Provider Type Product Number
- No reagents -