HPA015049

TMEM234 antibody from Atlas Antibodies
C1orf91, dJ622L5.7, FLJ90779, RP4-622L5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015049
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015049, RRID:AB_1235442
Product name
Anti-TMEM234
Provider product page
Atlas Antibodies - HPA015049
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DIGGKRKLDYCECGTQLCGSRHTCVSSFPEPISPE
WVRTRPFPILPFPLQLFCF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -