HPA015049

TMEM234 antibody from Atlas Antibodies
C1orf91, dJ622L5.7, FLJ90779, RP4-622L5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015049
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015049, RRID:AB_1856409
Product name
Anti-TMEM234
Provider product page
Atlas Antibodies - HPA015049
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DIGGKRKLDYCECGTQLCGSRHTCVSSFPEPISPE
WVRTRPFPILPFPLQLFCF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -