Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R31915 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- GSTA Antibody (alpha 1-5)
- Antibody type
- Polyclonal
- Antigen
- Amino acids MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE of human GSTA(1-5) were used as the immunogen for the GSTA antibody.
- Description
- Antigen affinity
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the GSTA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of 1) rat liver and 2) mouse liver lysate with GSTA antibody. Predicted/observed molecular weight ~25 kDa.
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Immunofluorescent staining of FFPE mouse liver with GSTA antibody (green) at 1ug/ml and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Immunofluorescent staining of FFPE rat liver with GSTA antibody (green) at 1ug/ml and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
