Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002938-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002938-M01, RRID:AB_425467
- Product name
- GSTA1 monoclonal antibody (M01), clone 2F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GSTA1.
- Antigen sequence
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFI
KSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA
ILNYIASKYNLYGKDIKERALIDMYIEGIADLGEM
ILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVL
KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLI
SSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE
KSLEEARKIFRF- Isotype
- IgG
- Antibody clone number
- 2F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Redox protein expression predicts radiotherapeutic response in early-stage invasive breast cancer patients.
Overcoming glutathione S-transferase P1-related cisplatin resistance in osteosarcoma.
Woolston CM, Al-Attar A, Storr SJ, Ellis IO, Morgan DA, Martin SG
International journal of radiation oncology, biology, physics 2011 Apr 1;79(5):1532-40
International journal of radiation oncology, biology, physics 2011 Apr 1;79(5):1532-40
Overcoming glutathione S-transferase P1-related cisplatin resistance in osteosarcoma.
Pasello M, Michelacci F, Scionti I, Hattinger CM, Zuntini M, Caccuri AM, Scotlandi K, Picci P, Serra M
Cancer research 2008 Aug 15;68(16):6661-8
Cancer research 2008 Aug 15;68(16):6661-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GSTA1 expression in transfected 293T cell line by GSTA1 monoclonal antibody (M01), clone 2F7.Lane 1: GSTA1 transfected lysate(26 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GSTA1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to GSTA1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol