HPA014740

KCNC4 antibody from Sigma-Aldrich
C1orf30, HKSHIIIC, Kv3.4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014740
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014740, RRID:AB_1855580
Product name
Anti-KCNC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014740
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily C member 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASE
KIIINVGGTRHETYRSTLRTLPGTRLAWLADPD
Storage
-20C
Provider Type Product Number
- No reagents -