HPA034643

APLF antibody from MilliporeSigma / Merck KGaA
C2orf13, MGC47799, Xip1, ZCCHH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA034643
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA034643, RRID:AB_10602431
Product name
Anti-APLF antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA034643
Antibody type
Polyclonal
Antigen
aprataxin and PNKP like factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGG
VQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHN
TLPVRNV
Storage
-20C
Provider Type Product Number
- No reagents -