HPA029396

PROKR1 antibody from MilliporeSigma / Merck KGaA
GPR73, GPR73a, PKR1, ZAQ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029396
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029396, RRID:AB_10610285
Product name
Anti-PROKR1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029396
Antibody type
Polyclonal
Antigen
prokineticin receptor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYS
DYDMPLDEDEDVTNSRTFF
Storage
-20C
Provider Type Product Number
- No reagents -