HPA014709

GRIK3 antibody from Sigma-Aldrich
GluK3, GLUR7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014709
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014709, RRID:AB_1850312
Product name
Anti-GRIK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014709
Antibody type
Polyclonal
Antigen
Glutamate receptor, ionotropic kainate 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REQRSFCSTVADEIRFSLTCQRRVKHKPQPPMMVK
TDAVINMHTFNDRRLPGKDSMACSTSLA
Storage
-20C
Provider Type Product Number
- No reagents -