Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009254-M12 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009254-M12, RRID:AB_1672294
- Product name
- CACNA2D2 monoclonal antibody (M12), clone 4E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CACNA2D2.
- Antigen sequence
PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYK
DNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQAL
KRLADAAENFQKAHRWQDNIKEEDIVYY- Isotype
- IgG
- Antibody clone number
- 4E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A novel null homozygous mutation confirms CACNA2D2 as a gene mutated in epileptic encephalopathy.
Pippucci T, Parmeggiani A, Palombo F, Maresca A, Angius A, Crisponi L, Cucca F, Liguori R, Valentino ML, Seri M, Carelli V
PloS one 2013;8(12):e82154
PloS one 2013;8(12):e82154
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CACNA2D2 monoclonal antibody (M12), clone 4E3. Western Blot analysis of CACNA2D2 expression in HeLa(Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CACNA2D2 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CACNA2D2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol