HPA016711

CNNM3 antibody from Sigma-Aldrich
ACDP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016711
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016711, RRID:AB_1847394
Product name
Anti-CNNM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016711
Antibody type
Polyclonal
Antigen
Metal transporter CNNM3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FTYYGVSALTVPSSVHQSPVSSLQPIRHDLQPDPG
DGTHSSAYCPDYTVRALSDLQLIKVTRLQYLNALL
ATRAQNLPQSPENTDLQVIPGSQTRLLGEKTTTA
Storage
-20C
Provider Type Product Number
- No reagents -