HPA032069

TRNAU1AP antibody from MilliporeSigma / Merck KGaA
FLJ20503, SECP43, TRSPAP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA032069
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA032069, RRID:AB_10603998
Product name
Anti-TRNAU1AP antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA032069
Antibody type
Polyclonal
Antigen
tRNA selenocysteine 1 associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYE
FFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELE
QK
Storage
-20C
Provider Type Product Number
- No reagents -