H00055974-B01

SLC50A1 antibody from Abnova Corporation
HsSWEET1, RAG1AP1, RP11-540D14.5, RZPDo834D038D, SCP, slv, SWEET1

Antibody data

Product number
H00055974-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055974-B01, RRID:AB_1138859
Product name
RAG1AP1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055974-B01
Antibody type
Polyclonal
Antigen
RAG1AP1 (AAH09621, 1 a.a. ~ 167 a.a) full-length human protein.
Description
Mouse polyclonal antibody raised against a full-length human RAG1AP1 protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRM
TRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILI
VVNTVGAALQTLYILAYLHYCPRKAKVIQTKSTQC
LSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPG
IVTSFIRFWLFWKYPQEQDRNYWLLQT
Vial size
50 μL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -