HPA018095

SLC50A1 antibody from Sigma-Aldrich
HsSWEET1, RAG1AP1, RP11-540D14.5, RZPDo834D038D, SCP, slv, SWEET1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018095
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018095, RRID:AB_1856048
Product name
Anti-RAG1AP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018095
Antibody type
Polyclonal
Antigen
RAG1-activating protein 1 (Stromal cell protein)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDG
Storage
-20C
Provider Type Product Number
- No reagents -