HPA016570

SLC35E1 antibody from Sigma-Aldrich
FLJ14251
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016570
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016570, RRID:AB_2190214
Product name
Anti-SLC35E1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016570
Antibody type
Polyclonal
Antigen
Solute carrier family 35 member E1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKTKYDANQQARKHLLPVTTADLSSKERHRSPLEK
PHNGLLFPQHGDYQYGRNNILTDHFQYSRQSYPNS
YSLNRYDV
Storage
-20C
Provider Type Product Number
- No reagents -